Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMED1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
$382.00 - $646.00
Specifications
Antigen | TMED1 |
---|---|
Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
TMED1 Polyclonal specifically detects TMED1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
TMED1 | |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
11018 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:PPIQDGEFTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDVDFTLESPQGVLLVSESRKADG | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Polyclonal | |
Rabbit | |
Human | |
Il1rl1l, IL1RL1LGIL1RL1-binding protein, interleukin 1 receptor-like 1 ligand, Interleukin-1 receptor-like 1 ligand, MGC1270, Putative T1/ST2 receptor-binding protein, ST2L, T1/ST2 receptor binding protein, transmembrane emp24 domain containing 1, transmembrane emp24 domain-containing protein 1, transmembrane emp24 protein transport domain containing 1 | |
TMED1 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title