Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMED3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP213439
Description
TMED3 Polyclonal specifically detects TMED3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
TMED3 | |
Polyclonal | |
Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:10-1:20 | |
C15orf22, chromosome 15 open reading frame 22, integral type I protein, Membrane protein p24B, MGC133022, p24B, transmembrane emp24 domain containing 3, transmembrane emp24 domain-containing protein 3, transmembrane emp24 protein transport domain containing 3,1200002G13Rik | |
Rabbit | |
Affinity Purified | |
RUO | |
23423 | |
Human | |
IgG |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
TMED3 | |
This antibody was developed against a recombinant protein corresponding to the amino acids: VGDEPPILPDMGNRVTALTQRFRGAYWKEVDKMVDYMQPGGTPATEGLGRLAPS | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction