Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ TMEM107 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA580138
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA580138 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA580138 Supplier Invitrogen™ Supplier No. PA580138
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: MCF-7 whole cell. IHC: human intestinal cancer tissue, human lung cancer tissue. Flow: A431 cell.

Gene ontology (GO) annotation includes embryonic digit morphogenesis; neural tube patterning; non-motile cilium assembly; protein localization to ciliary transition zone.
TRUSTED_SUSTAINABILITY

Specifications

Antigen TMEM107
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene TMEM107
Gene Accession No. Q6UX40
Gene Alias 1110004B13Rik; 2810049P21Rik; DC20; GRVS638; PRO1268; TMEM107; Transmembrane protein 107; UNQ638/PRO1268
Gene Symbols TMEM107
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human TMEM107 (22-57aa VITLFWSRDSNIQACLPLTFTPEEYDKQDIQLVAAL).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 84314
Target Species Human
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.