TMEM115 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169572

Catalog No. NBP169572

Description

TMEM115 Polyclonal specifically detects TMEM115 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TMEM115
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: PL6Placental protein 6, PP6, Protein PL6, transmembrane protein 115
• Host Species: Rabbit
• Molecular Weight of Antigen: 38 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Zebrafish: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q12893
• Gene Symbols: TMEM115
• Immunogen: Synthetic peptides corresponding to TMEM115(transmembrane protein 115) The peptide sequence was selected from the N terminal of TMEM115. Peptide sequence LLSFAVDTGCLAVTPGYLFPPNFWIWTLATHGLMEQHVWDVAISLTTVVV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 11070
• Reconstitution: Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only