TMEM119 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 5 publications

Supplier:  Novus Biologicals NBP230551

Catalog No. NBP230551

Description

TMEM119 Polyclonal specifically detects TMEM119 in Human, Rat, Porcine, Feline samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.

Specifications

• Antigen: TMEM119
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL, Immunohistochemistry-Paraffin 1:50 - 1:200, Immunohistochemistry-Frozen 1:50 - 1:200
• Gene Accession No.: Q4V9L6
• Gene Symbols: TMEM119
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ITRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALD
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of human TMEM119 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: OBIF, Osteoblast Induction Factor, TMEM119
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 338773
• Target Species: Human, Rat
• Isotype: IgG

For Research Use Only