Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TMEM165 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. p-7246722 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB166156 20 μg
NB166155 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB166156 Supplier Novus Biologicals Supplier No. NBP31553020UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

TMEM165 Polyclonal antibody specifically detects TMEM165 in Human samples. It is validated for Western Blot

Specifications

Antigen TMEM165
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000
Formulation PBS, 50% glycerol, pH7.3
Gene Alias transmembrane protein 165
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 172-230 of human TMEM165 (NP_060945.2). IRMLREGLKMSPDEGQEELEEVQAELKKKDEEFQRTKLLNGPGDVETGTSITVPQKKWL
Purification Method Affinity purified
Quantity 20 μg
Regulatory Status RUO
Research Discipline Cell Biology
Primary or Secondary Primary
Gene ID (Entrez) 55858
Target Species Human
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.