Learn More
Invitrogen™ TMEM166 Polyclonal Antibody
Rabbit Polyclonal Antibody
Supplier: Invitrogen™ PA595621
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HepG2 whole cell, human PC-3 whole cell. IHC: human liver cancer tissue, human renal cancer tissue. Flow: A549 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Acts as a regulator of programmed cell death, mediating both autophagy and apoptosis. Expressed in lung, kidney, liver, pancreas, placenta, but not in heart and skeletal muscle.
Specifications
TMEM166 | |
Polyclonal | |
Unconjugated | |
EVA1A | |
BC014699; eva-1 homolog A; eva-1 homolog A (C. elegans); eva-1 homolog A, regulator of programmed cell death; EVA1A; fam176a; family with sequence similarity 176, member A; protein eva-1 homolog A; Protein FAM176A; RGD1559797; SP24; tm166; tmem166; transmembrane protein 166; zgc:153298 | |
Rabbit | |
Affinity chromatography | |
RUO | |
232146, 500221, 84141 | |
-20°C | |
Lyophilized |
Flow Cytometry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry | |
500 μg/mL | |
PBS with 4mg trehalose and 0.05mg sodium azide | |
Q91WM6, Q9H8M9 | |
EVA1A | |
A synthetic peptide corresponding to a sequence of human TMEM166/EVA1A (MRLPLSHSPEHVEMALLSNILAAYSFVSENPERA) (aa 1-34). | |
100 μg | |
Primary | |
Human, Mouse, Rat | |
Antibody | |
IgG |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.