Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMEM206 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $499.50
Specifications
Antigen | TMEM206 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP17072920
![]() |
Novus Biologicals
NBP17072920UL |
20 μL |
Each for $206.00
|
|
|||||
NBP170729
![]() |
Novus Biologicals
NBP170729 |
100 μL |
Each for $499.50
|
|
|||||
Description
TMEM206 Polyclonal specifically detects TMEM206 in Human samples. It is validated for Western Blot.Specifications
TMEM206 | |
Polyclonal | |
Rabbit | |
transmembrane protein 206 | |
TMEM206 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
55248 | |
Synthetic peptides corresponding to C1ORF75 The peptide sequence was selected from the N terminal of C1ORF75. Peptide sequence IFIYLLLMAVAVFLVYRTITDFREKLKHPVMSVSYKEVDRYDAPGIALYP. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title