Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMEM222 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | TMEM222 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TMEM222 Polyclonal specifically detects TMEM222 in Human samples. It is validated for Western Blot.Specifications
TMEM222 | |
Polyclonal | |
Rabbit | |
NP_115501 | |
84065 | |
The immunogen for this antibody is TMEM222. Peptide sequence WKLDPAQVYASGPNAWDTAVHDASEEYKHRMHNLCCDNCHSHVALALNLM. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
C1orf160, chromosome 1 open reading frame 160, DKFZp564D0478, MGC111002, transmembrane protein 222 | |
TMEM222 | |
IgG | |
23 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title