TMEM231 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159823

Catalog No. NBP159823

Description

TMEM231 Polyclonal specifically detects TMEM231 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TMEM231
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ALYE870, FLJ22167, PRO1886, transmembrane protein 231
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79583
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q9H6L2
• Gene Symbols: TMEM231
• Immunogen: Synthetic peptides corresponding to TMEM231. The peptide sequence was selected from the N terminal of TMEM231. Peptide sequence CHEAPRARSARAGLPNRLPTALFNSGFWLKRSSYEEQPTVRFQHQVLLVA.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Sumatran orangutan: 100%; Crab-eating macaque: 100%; Human: 100%; Mouse: 92%; Rat: 85%; Zebrafish: 85%; Western clawed frog: 78%; Green puffer: 78%;.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified