Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMEM42 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | TMEM42 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TMEM42 Polyclonal specifically detects TMEM42 in Human samples. It is validated for Western Blot.Specifications
TMEM42 | |
Polyclonal | |
Rabbit | |
MGC29956, transmembrane protein 42 | |
TMEM42 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
131616 | |
Synthetic peptides corresponding to TMEM42 (transmembrane protein 42) The peptide sequence was selected from the N terminal of TMEM42)(50ug). Peptide sequence MAERPGPPGGAVSATAYPDTPAEFPPHLQAGAMRRRFWGVFNCLCAGAFG. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title