Novus Biologicals™ TMEM49 Recombinant Protein Antigen

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TMEM49. Source: E.coli Amino Acid Sequence: MAENGKNCDQRRVAMNKEHHNGNFTDPSSVNEKKRREREERQNIVLWRQP The TMEM49 Recombinant Protein Antigen is derived from E. coli. The TMEM49 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 81671
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: TMEM49 Recombinant Protein Antigen
• Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
• Formulation: PBS and 1M Urea, pH 7.4.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: DKFZp566I133, EPG3, TDC1, transmembrane protein 49TMEM49, vacuole membrane protein 1
• Gene Symbol: VMP1
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Research Category: Autophagy, Cancer, ER Markers, Membrane Trafficking and Chaperones, Neurodegeneration
• Source: E.Coli
• Specific Reactivity: Human

For Research Use Only