Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMEM51 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16259020UL
Description
TMEM51 Polyclonal specifically detects TMEM51 in Human samples. It is validated for Western Blot.Specifications
TMEM51 | |
Polyclonal | |
Western Blot | |
Q9NW97 | |
TMEM51 | |
Synthetic peptides corresponding to TMEM51(transmembrane protein 51) The peptide sequence was selected form the N terminal of TMEM51. Peptide sequence GFSAAEKPTAQGSNKTEVGGGILKSKTFSVAYVLVGAGVMLLLLSICLSI. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
C1orf72, chromosome 1 open reading frame 72, FLJ10199, transmembrane protein 51 | |
Rabbit | |
Affinity Purified | |
RUO | |
55092 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction