Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMEM55B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$336.16 - $690.48
Specifications
| Antigen | TMEM55B |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:10-1:20 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
TMEM55B Polyclonal specifically detects TMEM55B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| TMEM55B | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 90809 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: GHPAVLPGEDPPPYSPLTSPDSGSAPMITCRVCQS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:10-1:20 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| C14orf9, chromosome 14 open reading frame 9, DKFZp434M0519, EC 3.1.3.78, MGC26684, PtdIns-4,5-P(2) 4-phosphatase type I, PtdIns-4,5-P2 4-Ptase I, transmembrane protein 55B, Type I phosphatidylinositol 4,5-bisphosphate 4-phosphatase | |
| TMEM55B | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title