Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ TMSB4X Recombinant Protein

$503.00 - $775.00

Specifications

Accession Number AAH01631.2
For Use With (Application) Antibody Production, Protein Array, ELISA, Western Blot
Formulation 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gene ID (Entrez) 7114
Molecular Weight (g/mol) 30.47
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
89-010-926
View Documents
Abnova™
H00007114P0110
10 ug
Each for $503.00
Add to Cart
 
89-010-927
View Documents
Abnova™
H00007114P0125
25 ug
Each for $775.00
Add to Cart
 
Description

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Specifications

AAH01631.2
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
30.47
8
Glutathione Sepharose 4 Fast Flow
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
TMSB4X
Human
Recombinant
Solution
Antibody Production, Protein Array, ELISA, Western Blot
7114
TMSB4X (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
FX/PTMB4/TB4X/TMSB4
TMSB4X
Wheat Germ (in vitro)
GST
SDS
Documents

Documents

Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit