Invitrogen™ Tnfaip6 Polyclonal Antibody

Catalog No.	Quantity
PIPA595423	100 μg

Catalog No. PIPA595423 Supplier Invitrogen™ Supplier No. PA595423

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat brain tissue, human Hela whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The TSG6 gene is transcribed in normal fibroblasts and activated by binding of the cytokines TNF alpha and IL-1 at AP-1 and NF-IL6 sites in its promoter. TSG-6 is a glycoprotein and a member of the hyaluronan-binding protein family, which includes cartilage link protein, proteoglycan core protein and the adhesion receptor CD44. TSG-6 is highly homologous to CD44, particularly in the hyaluronic acid-binding domain. TSG-6 is found in TNF-treated cells; its expression is rapidly activated by TNF alpha, IL-1 and lipopolysaccharide in normal fibroblasts, peripheral blood mononuclear cells, synovial cells and chondrocytes. The presence of TSG-6 in synovial fluid suggests a possible role in rheumatoid arthritis. TSG-6 forms a stable complex with components of the serine protease inhibitor, inter-alpha-inhibitor (I alpha I)). TSG-6 potentiates the inhibitory effect of l alpha l on the protease activity of plasmin. Through their cooperative inhibitory effect on plasmin, TSG-6 and l alpha l can modulate the protease network and thus inhibit inflammation.

Specifications

• Antigen: Tnfaip6
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 500 μg/mL
• Conjugate: Unconjugated
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene: TNFAIP6
• Gene Accession No.: P98066
• Gene Alias: Hyaluronate-binding protein; TNF alpha induced protein 6; TNF alpha-induced protein 6; Tnfaip6; Tnfip6; TNF-stimulated gene 6 protein; TSG6; TSG-6; tumor necrosis factor alpha induced protein 6; tumor necrosis factor alpha-induced protein 6; tumor necrosis factor alpha-inducible protein 6; tumor necrosis factor induced protein 6; tumor necrosis factor, alpha induced protein 6; tumor necrosis factor, alpha-induced protein 6; tumor necrosis factor-inducible gene 6 protein; tumor necrosis factor-stimulated gene-6 protein
• Gene Symbols: TNFAIP6
• Host Species: Rabbit
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human TSG6 (46-91aa KYKLTYAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGR).
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 7130, 84397
• Target Species: Human, Rat
• Content And Storage: -20°C
• Product Type: Antibody
• Form: Lyophilized
• Isotype: IgG