Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Tnfaip6 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA595423
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA595423 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA595423 Supplier Invitrogen™ Supplier No. PA595423
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat brain tissue, human Hela whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The TSG6 gene is transcribed in normal fibroblasts and activated by binding of the cytokines TNF alpha and IL-1 at AP-1 and NF-IL6 sites in its promoter. TSG-6 is a glycoprotein and a member of the hyaluronan-binding protein family, which includes cartilage link protein, proteoglycan core protein and the adhesion receptor CD44. TSG-6 is highly homologous to CD44, particularly in the hyaluronic acid-binding domain. TSG-6 is found in TNF-treated cells; its expression is rapidly activated by TNF alpha, IL-1 and lipopolysaccharide in normal fibroblasts, peripheral blood mononuclear cells, synovial cells and chondrocytes. The presence of TSG-6 in synovial fluid suggests a possible role in rheumatoid arthritis. TSG-6 forms a stable complex with components of the serine protease inhibitor, inter-alpha-inhibitor (I alpha I)). TSG-6 potentiates the inhibitory effect of l alpha l on the protease activity of plasmin. Through their cooperative inhibitory effect on plasmin, TSG-6 and l alpha l can modulate the protease network and thus inhibit inflammation.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Tnfaip6
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene TNFAIP6
Gene Accession No. P98066
Gene Alias Hyaluronate-binding protein; TNF alpha induced protein 6; TNF alpha-induced protein 6; Tnfaip6; Tnfip6; TNF-stimulated gene 6 protein; TSG6; TSG-6; tumor necrosis factor alpha induced protein 6; tumor necrosis factor alpha-induced protein 6; tumor necrosis factor alpha-inducible protein 6; tumor necrosis factor induced protein 6; tumor necrosis factor, alpha induced protein 6; tumor necrosis factor, alpha-induced protein 6; tumor necrosis factor-inducible gene 6 protein; tumor necrosis factor-stimulated gene-6 protein
Gene Symbols TNFAIP6
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human TSG6 (46-91aa KYKLTYAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGR).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7130, 84397
Target Species Human, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.