Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TNNI3K Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | TNNI3K |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TNNI3K Polyclonal specifically detects TNNI3K in Human samples. It is validated for Western Blot.Specifications
TNNI3K | |
Polyclonal | |
Rabbit | |
Protein Kinase | |
CARKCardiac ankyrin repeat kinase, EC 2.7.11.1, MGC142099, MGC33828, serine/threonine-protein kinase TNNI3K, TNNI3 interacting kinase, TNNI3-interacting kinase | |
TNNI3K | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q59H18-2 | |
51086 | |
Synthetic peptides corresponding to TNNI3K(TNNI3 interacting kinase) The peptide sequence was selected from the middle region of TNNI3K. Peptide sequence PGRSHVAALRSRFELEYALNARSYAALSQSAGQYSSQGLSLEEMKRSLQY. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title