Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TOB1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17947620UL
Description
TOB1 Polyclonal specifically detects TOB1 in Human samples. It is validated for Western Blot.Specifications
TOB1 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_005740 | |
TOB1 | |
Synthetic peptide directed towards the middle region of human TOB1The immunogen for this antibody is TOB1. Peptide sequence DLLKQKAISSSMHSLYGLGLGSQQQPQQQQQPAQPPPPPPPPQQQQQQKT. | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
APRO6, MGC104792, PIG49, protein Tob1, TOBMGC34446, Transducer of erbB-2 1, transducer of ERBB2, 1, TROB, TROB1 | |
Rabbit | |
38 kDa | |
20 μL | |
Cell Cycle and Replication | |
10140 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction