Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TOB1 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen TOB1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP17947620
SDP
View Documents
Novus Biologicals
NBP17947620UL
20 μL
Each for $206.00
Only null left
Add to Cart
 
NBP179476
SDP
View Documents
Novus Biologicals
NBP179476
100 μL
Each for $487.50
Only null left
Add to Cart
 
Description

Description

TOB1 Polyclonal specifically detects TOB1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

TOB1
Polyclonal
Rabbit
Cell Cycle and Replication
APRO6, MGC104792, PIG49, protein Tob1, TOBMGC34446, Transducer of erbB-2 1, transducer of ERBB2, 1, TROB, TROB1
TOB1
IgG
38 kDa
Western Blot
Unconjugated
RUO
NP_005740
10140
Synthetic peptide directed towards the middle region of human TOB1The immunogen for this antibody is TOB1. Peptide sequence DLLKQKAISSSMHSLYGLGLGSQQQPQQQQQPAQPPPPPPPPQQQQQQKT.
Primary
Videos
SDS
Documents

Documents

Product Certifications
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.