Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Topoisomerase I Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$416.50 - $672.50

Specifications

Antigen	Topoisomerase I
Dilution	Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000, Proximity Ligation Assay Reported in scientific literature (PMID:35013124).
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Proximity Ligation Assay
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB430369 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP19036525UL	25 μL	Each for $416.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP190365 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP190365	0.1 mL	Each for $672.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

Topoisomerase I Polyclonal specifically detects Topoisomerase I in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	Topoisomerase I
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Proximity Ligation Assay
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human, Mouse, Rat
Gene Alias	DNA topoisomerase 1, DNA topoisomerase I, EC 5.99.1.2, TOPI, topoisomerase (DNA) I, type I DNA topoisomerase
Gene Symbols	TOP1
Isotype	IgG
Purification Method	Affinity Purified
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Dilution	Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000, Proximity Ligation Assay Reported in scientific literature (PMID:35013124).
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Cell Cycle and Replication, DNA Repair, DNA replication Transcription Translation and Splicing
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	7150
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:KVRASGDAKIKKEKENGFSSPPQIKDEPEDDGYFVPPKEDIKPLKRPRDEDDADYKPKK
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Topoisomerase I Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents