Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TOR/mTOR Antibody, Novus Biologicals™

TOR/mTOR Antibody, Novus Biologicals™
SDP

Catalog No. NBP255920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP255920 100 μL
NB394754 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP255920 Supplier Novus Biologicals Supplier No. NBP255920
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

TOR/mTOR Polyclonal specifically detects TOR/mTOR in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen TOR/mTOR
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias EC 2.7.11.1, FK506 binding protein 12-rapamycin associated protein 1, FK506 binding protein 12-rapamycin associated protein 2, FK506-binding protein 12-rapamycin complex-associated protein 1, FKBP12-rapamycin complex-associated protein, FLJ44809, FRAP, FRAP1FKBP12-rapamycin complex-associated protein 1, FRAP2, Mammalian target of rapamycin, Mechanistic target of rapamycin, mechanistic target of rapamycin (serine/threonine kinase), mTOR, RAFT1, rapamycin and FKBP12 target 1, rapamycin associated protein FRAP2, Rapamycin target protein 1, RAPT1FKBP-rapamycin associated protein, serine/threonine-protein kinase mTOR
Gene Symbols MTOR
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TESLDSTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLICRIVKGYTLADE
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Autophagy, Cancer, Cell Cycle and Replication, DNA Repair, Hypoxia, Macroautophagy, MAP Kinase Signaling, mTOR Pathway, Signal Transduction, Translation Control
Primary or Secondary Primary
Gene ID (Entrez) 2475
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.