TOR1AIP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP234109

Catalog No. NBP234109

Description

TOR1AIP2 Polyclonal specifically detects TOR1AIP2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TOR1AIP2
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: Q9H496
• Gene Symbols: TOR1AIP2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPECYPDNPANRSLV
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: FLJ77012, IFRG15, interferon responsive gene 15, LULL1MGC120077, lumenal domain like LAP1, Lumenal domain-like LAP1, MGC120074, MGC120075, MGC120076, MGC126581, MGC138430, NET9, RP11-12M5.5, torsin A interacting protein 2, torsin-1A-interacting protein 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 163590
• Target Species: Human
• Isotype: IgG

For Research Use Only