TORC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP189865

Catalog No. NBP189865

Description

TORC1 Polyclonal antibody specifically detects TORC1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin).

Specifications

• Antigen: TORC1
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: CREB regulated transcription coactivator 1, FLJ14027WAMTP1, KIAA0616Transducer of regulated cAMP response element-binding protein 1, MECT1CREB-regulated transcription coactivator 1, mucoepidermoid carcinoma translocated 1, Mucoepidermoid carcinoma translocated protein 1, TORC1TORC-1, Transducer of CREB protein 1, transducer of regulated cAMP response element-binding protein (CREB) 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of human TORC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CRTC1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SPPADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKKTGSRPKSCEV
• Quantity: 0.1 mL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 23373
• Target Species: Human, Mouse, Rat
• Isotype: IgG

For Research Use Only