TORC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB405745	Novus Biologicals NBP18986525UL	25 μL
NBP189865	Novus Biologicals NBP189865	0.1 mL

Description

TORC1 Polyclonal antibody specifically detects TORC1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin).

Specifications

• Antigen: TORC1
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human, Mouse, Rat
• Gene Alias: CREB regulated transcription coactivator 1, FLJ14027WAMTP1, KIAA0616Transducer of regulated cAMP response element-binding protein 1, MECT1CREB-regulated transcription coactivator 1, mucoepidermoid carcinoma translocated 1, Mucoepidermoid carcinoma translocated protein 1, TORC1TORC-1, Transducer of CREB protein 1, transducer of regulated cAMP response element-binding protein (CREB) 1
• Gene Symbols: CRTC1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of human TORC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Protein Kinase
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 23373
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:SPPADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKKTGSRPKSCEV
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only