Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ TORC2 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579072
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579072 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579072 Supplier Invitrogen™ Supplier No. PA579072
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human MCF-7 whole cell, human A375 whole cell.

CRTC2, also known as TORC2 (Transducers Of Regulated cAMP Response Element-Binding (CREB)) 2 and the related protein CRTC1 are potent CREB coactivators that are exported from the nucleus in a CRM1-dependent manner via phosphorylation-dependent interactions. Studies suggest that their phosphorylation and nuclear/cytoplasmic shuttling play an important role in the regulation of gluconeogenesis by cAMP. CRTC2 is present in both B and T-lymphocytes and abundantly expressed in the thymus. Its activity is important in regulating the expression of genes involved in cellular energy metabolism while CRTC1 is essential for energy balance and fertility.
TRUSTED_SUSTAINABILITY

Specifications

Antigen TORC2
Applications Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene CRTC2
Gene Accession No. Q3LRZ1, Q3U182, Q53ET0
Gene Alias 4632407F12Rik; CREB regulated transcription coactivator 2; CREB-regulated transcription coactivator 2; CRTC2; mTORC2; OTTHUMP00000035255; RGD1308903; TORC2; TORC-2; transducer of CREB protein 2; transducer of regulated cAMP response element-binding protein (CREB) 2; transducer of regulated cAMP response element-binding protein 2
Gene Symbols CRTC2
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human TORC2 (EKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLAYTR).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 200186, 310615, 74343
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.