TP53I13 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179465

Catalog No. NBP179465

Description

TP53I13 Polyclonal specifically detects TP53I13 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TP53I13
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DSCP1Damage-stimulated cytoplasmic protein 1, tumor protein p53 inducible protein 13, tumor protein p53-inducible protein 13
• Host Species: Rabbit
• Molecular Weight of Antigen: 42 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Dog: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_612358
• Gene Symbols: TP53I13
• Immunogen: Synthetic peptide directed towards the C terminal of human TP53I13The immunogen for this antibody is TP53I13. Peptide sequence YWGPTADSQDTVAAVLKRRLLQPSRRVKRSRRRPLLPPTPDSGPEGESSE.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 90313
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.