Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TPD52L3/D55 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | TPD52L3/D55 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP156498
![]() |
Novus Biologicals
NBP156498 |
100 μL |
Each for $480.74
|
|
|||||
NBP15649820
![]() |
Novus Biologicals
NBP15649820UL |
20 μL | N/A | N/A | N/A | ||||
Description
TPD52L3/D55 Polyclonal specifically detects TPD52L3/D55 in Human samples. It is validated for Western Blot.Specifications
| TPD52L3/D55 | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| hD55, MGC26757, NYDSP25, NYD-SP25, protein kinase NYD-SP25, Testis development protein NYD-SP25, tumor protein D52-like 3MGC45374, tumor protein D55 | |
| TPD52L3 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q96J77-2 | |
| 89882 | |
| Synthetic peptides corresponding to TPD52L3(tumor protein D52-like 3) The peptide sequence was selected from the middle region of TPD52L3. Peptide sequence GLRQNLSKSWLDVQVSNTYVKQKTSAALSTMGTLICRKLGGVKKSATLRS. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title