Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TR beta 1/NR1A2/Thyroid Hormone Receptor beta Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | TR beta 1/NR1A2/Thyroid Hormone Receptor beta |
---|---|
Dilution | Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
TR beta 1/NR1A2/Thyroid Hormone Receptor beta Polyclonal specifically detects TR beta 1/NR1A2/Thyroid Hormone Receptor beta in Mouse samples. It is validated for Western Blot, Chromatin Immunoprecipitation.Specifications
TR beta 1/NR1A2/Thyroid Hormone Receptor beta | |
Polyclonal | |
Purified | |
RUO | |
Mouse | |
avian erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, c-erbA-2, c-erbA-beta, ERBA2MGC126109, ERBA-BETA, GRTH, MGC126110, NR1A2thyroid hormone receptor, beta (avian erythroblastic leukemia viral (v-erb-a)oncogene homolog 2), Nuclear receptor subfamily 1 group A member 2, oncogene ERBA2, PRTH, THR1pituitary resistance to thyroid hormone, THRB1, THRB2, thyroid hormone receptor beta, thyroid hormone receptor beta 1, thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a)oncogene homolog 2, avian) | |
The immunogen is a synthetic peptide directed towards the n terminal region of mouse TR beta 1/NR1A2/Thyroid Hormone Receptor beta (NP_033406). Peptide sequence MNYCMPEVHEVCPAASSNCYMQVTDYLAYLEDSPALSGRDVQAVPSSSIY | |
Affinity purified |
Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation | |
Unconjugated | |
Rabbit | |
Cancer, Neuroscience | |
PBS buffer, 2% sucrose | |
7068 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title