TR2/NR2C1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255132

Catalog No. NBP255132

Description

TR2/NR2C1 Polyclonal specifically detects TR2/NR2C1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: TR2/NR2C1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: nuclear receptor subfamily 2 group C member 1, nuclear receptor subfamily 2, group C isoform, nuclear receptor subfamily 2, group C, member 1, Orphan nuclear receptor TR2, Testicular receptor 2, TR2, TR2 nuclear hormone receptor, TR2-11
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 7181
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: NR2C1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QFILTNHDGSTPSKVILARQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSPDQGPNKV
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only