TRA2A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB438501	Novus Biologicals NBP21347325UL	25ul
NBP213473	Novus Biologicals NBP213473	0.1 mL

Description

TRA2A Polyclonal specifically detects TRA2A in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TRA2A
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: HSU53209, htra-2 alpha, htra-2-alpha, putative MAPK activating protein PM24, TRA-2 alpha, tra2a, Tra2alpha, TRA2-alpha, transformer 2 alpha homolog (Drosophila), transformer-2 alpha, Transformer-2 protein homolog A, transformer-2 protein homolog alpha
• Gene Symbols: TRA2A
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20-1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cancer, GPCR, Neuroscience
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 29896
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSR
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only