TRAF-6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18082525UL

Catalog No. NB407380

Description

TRAF-6 Polyclonal specifically detects TRAF-6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TRAF-6
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200-1:500
• Gene Alias: E3 ubiquitin-protein ligase TRAF6, EC 6.3.2.-, Interleukin-1 signal transducer, RING finger protein 85, RNF85MGC:3310, TNF receptor-associated factor 6
• Host Species: Rabbit
• Molecular Weight of Antigen: 60 kDa
• Quantity: 25ul
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: TRAF6
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ISEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPV
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 7189
• Target Species: Human
• Isotype: IgG

For Research Use Only