Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRAF3IP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18926325UL
Description
TRAF3IP2 Polyclonal specifically detects TRAF3IP2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
TRAF3IP2 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
ACT1DKFZP586G0522, adapter protein CIKS, C6orf2, C6orf4chromosome 6 open reading frame 5, C6orf5DKFZp586G0522, C6orf6MGC3581, CIKSchromosome 6 open reading frame 2, Connection to IKK and SAPK/JNK, NFkB-activating protein ACT1, Nuclear factor NF-kappa-B activator 1, TRAF3 interacting protein 2, TRAF3-interacting protein 2 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
TRAF3IP2 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:KQDVEGAESQLDEDEHGLHTKYIHRMMQIEFIKQGSMNFRFIPVLFPNAKKEHVPTWLQNTHVYSWPKNKKNILLRLLR | |
25 μL | |
Signal Transduction | |
10758 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction