Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Transglutaminase 7/TGM7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Transglutaminase 7/TGM7 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Transglutaminase 7/TGM7 Polyclonal specifically detects Transglutaminase 7/TGM7 in Human samples. It is validated for Western Blot.Specifications
Transglutaminase 7/TGM7 | |
Polyclonal | |
Rabbit | |
Cancer | |
protein-glutamine gamma-glutamyltransferase Z, TG(Z), TGase Z, TGase-7, TGMZEC 2.3.2.13, TGZ, transglutaminase 7, Transglutaminase Z, transglutaminase-7 | |
TGM7 | |
IgG | |
80 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q96PF1 | |
116179 | |
Synthetic peptides corresponding to TGM7(transglutaminase 7) The peptide sequence was selected from the C terminal of TGM7. Peptide sequence TQKPFWRHTVRMNLDFGKETQWPLLLPYSNYRNKLTDEKLIRVSGIAEVE. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title