Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRAPPC2L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | TRAPPC2L |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TRAPPC2L Polyclonal specifically detects TRAPPC2L in Human samples. It is validated for Western Blot.Specifications
TRAPPC2L | |
Polyclonal | |
Rabbit | |
MGC111156, trafficking protein particle complex 2-like, trafficking protein particle complex subunit 2-like protein | |
TRAPPC2L | |
IgG | |
This product is specific to Subunit or Isoform: 2-like protein. |
Western Blot | |
Unconjugated | |
RUO | |
51693 | |
Synthetic peptides corresponding to TRAPPC2L(trafficking protein particle complex 2-like) The peptide sequence was selected from the N terminal of TRAPPC2L. Peptide sequence MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKAL. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title