Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRAPPC4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | TRAPPC4 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TRAPPC4 Polyclonal specifically detects TRAPPC4 in Human samples. It is validated for Western Blot.Specifications
TRAPPC4 | |
Polyclonal | |
Rabbit | |
NP_057230 | |
51399 | |
Synthetic peptide directed towards the middle region of human TRAPPC4The immunogen for this antibody is TRAPPC4. Peptide sequence EKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHCYQTLTGIKFV. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Hematopoietic stem/progenitor cell protein 172, PTD009, SBDNHSPC172, Synbindin, trafficking protein particle complex 4, trafficking protein particle complex subunit 4, TRS23, TRS23 homolog | |
TRAPPC4 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title