Trappin-2/Elafin/Skalp Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 3 publications

Catalog Number	Mfr. No.	Quantity
NB432273	Novus Biologicals NBP18569025UL	25 μL
NBP185690	Novus Biologicals NBP185690	0.1 mL

Description

Trappin-2/Elafin/Skalp Polyclonal specifically detects Trappin-2/Elafin/Skalp in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Trappin-2/Elafin/Skalp
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: cementoin, Elastase-specific inhibitor, ESIWAP four-disulfide core domain protein 14, Peptidase inhibitor 3, peptidase inhibitor 3, skin-derived, PI-3, pre-elafin, protease inhibitor 3, skin-derived (SKALP), Protease inhibitor WAP3, SKALPELAFIN, Skin-derived antileukoproteinase, trappin-2, WAP four-disulfide core domain 14, WAP3MGC13613, WFDC14elafin
• Gene Symbols: PI3
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cancer, Immunology
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 5266
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMA
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only