Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Trappin-2/Elafin/Skalp Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 3 publications
$382.00 - $646.00
Specifications
Antigen | Trappin-2/Elafin/Skalp |
---|---|
Dilution | Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Trappin-2/Elafin/Skalp Polyclonal specifically detects Trappin-2/Elafin/Skalp in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Trappin-2/Elafin/Skalp | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
cementoin, Elastase-specific inhibitor, ESIWAP four-disulfide core domain protein 14, Peptidase inhibitor 3, peptidase inhibitor 3, skin-derived, PI-3, pre-elafin, protease inhibitor 3, skin-derived (SKALP), Protease inhibitor WAP3, SKALPELAFIN, Skin-derived antileukoproteinase, trappin-2, WAP four-disulfide core domain 14, WAP3MGC13613, WFDC14elafin | |
PI3 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
Polyclonal | |
Rabbit | |
Cancer, Immunology | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
5266 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:KGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMA | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title