Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRIAD3 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309357100UL
Description
TRIAD3 Polyclonal specifically detects TRIAD3 in Mouse samples. It is validated for Western Blot.Specifications
TRIAD3 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
EC 6.3.2.-, ring finger protein 216Ubiquitin-conjugating enzyme 7-interacting protein 1, Triad domain-containing protein 3, TRIAD3Zinc finger protein inhibiting NF-kappa-B, U7I1, UBCE7IP1ubiquitin conjugating enzyme 7 interacting protein 1, ZINE3 ubiquitin-protein ligase RNF216 | |
The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE TRIAD3. Peptide sequence IVNPRLEQKVIILGENGLLFPESEPLEVQNQSSEDSETELLSNPGEPAAS | |
100 μg | |
Primary | |
Mouse | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
54476 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction