Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRIB1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | TRIB1 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TRIB1 Polyclonal specifically detects TRIB1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
TRIB1 | |
Polyclonal | |
Rabbit | |
Protein Kinase | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
10221 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VRSAMSGASQPRGPALLFPATRGVPAKRLLDADDAAAVAAKCPRLSECSSPPDYLSPP | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
C8FWG-protein-coupled receptor induced protein, GIG-2, GIG2G-protein-coupled receptor-induced protein 2, G-protein-coupled receptor-induced gene 2 protein, SKIP1, TRB-1, TRB1phosphoprotein regulated by mitogenic pathways, tribbles homolog 1, tribbles homolog 1 (Drosophila), tribbles-like protein 1 | |
TRIB1 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title