Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRIB3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | TRIB3 |
---|---|
Dilution | Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
TRIB3 Polyclonal specifically detects TRIB3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
TRIB3 | |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
C20orf97, dJ1103G7.3, neuronal cell death inducible putative kinase, Neuronal cell death-inducible putative kinase, NIPK, p65-interacting inhibitor of NF-kappaB, p65-interacting inhibitor of NF-kappa-B, SINK, SKIP3, TRB-3, TRB3chromosome 20 open reading frame 97, tribbles homolog 3, tribbles homolog 3 (Drosophila) | |
TRIB3 | |
IgG | |
Affinity Purified |
Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Polyclonal | |
Rabbit | |
Apoptosis, Cancer, Hypoxia | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
57761 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VKNNRMSANNDHFLTPTWQQMRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRATAV | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title