Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRIM10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP21347925UL
Description
TRIM10 Polyclonal specifically detects TRIM10 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
TRIM10 | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
B30-RING finger protein, HERF1hematopoietic RING finger 1, RFB30MGC141979, RING finger protein 9, RNF9tripartite motif protein 10, tripartite motif containing 10, tripartite motif-containing 10, tripartite motif-containing protein 10, Zn-finger protein | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
TRIM10 | |
This antibody was developed against a recombinant protein corresponding to the amino acids: IQSRENKRMQVLLTQVSTKRQQVISEFAHLRKFLEEQQSILLAQLESQDGDILRQRDEFDLLVAGEICRFS | |
25ul | |
Zinc Finger | |
10107 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction