TRIM23 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Catalog Number	Mfr. No.	Quantity
NB431079	Novus Biologicals NBP18884625UL	25 μL
NBP188846	Novus Biologicals NBP188846	0.1 mL

Description

TRIM23 Polyclonal specifically detects TRIM23 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TRIM23
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Signal Transduction, Zinc Finger
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 373
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LGDSGVWGLKKNFALLELLERLQNGPIGQYGAAEESIGISGESITRCDEDEAHLASVYCTVCATHLCSECSQVTHST
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: ADP-ribosylation factor domain protein 1, 64kDa, ADP-ribosylation factor domain-containing protein 1, ARD1GTP-binding protein ARD-1, ARF domain protein 1, ARFD1, E3 ubiquitin-protein ligase TRIM23, EC 6.3.2.-, RNF46RING finger protein 46, tripartite motif containing 23, tripartite motif protein TRIM23, tripartite motif-containing 23, Tripartite motif-containing protein 23
• Gene Symbols: TRIM23
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only