Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRIM26 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $627.50
Specifications
Antigen | TRIM26 |
---|---|
Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TRIM26 Polyclonal specifically detects TRIM26 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
TRIM26 | |
Polyclonal | |
Rabbit | |
Zinc Finger | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
7726 | |
This antibody was developed against a recombinant protein corresponding to amino acids: FKKENIRPVWQLASLVENIERLKVDKGRQPGEVTREQQDAKLCERHREKLHYYCEDDGKLLCVM | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
Acid finger protein, AFP, RNF95RING finger protein 95, tripartite motif containing 26, tripartite motif-containing protein 26, widely expressed acid zinc finger protein, Zinc finger protein 173, ZNF173tripartite motif-containing 26 | |
TRIM26 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?
Product Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title