TRIM40 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP192530

Catalog No. NBP192530

Description

TRIM40 Polyclonal specifically detects TRIM40 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TRIM40
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: RING finger protein 35, ring finger RNF35, RNF35ring finger protein 40, tripartite motif containing 40, tripartite motif-containing 40, tripartite motif-containing protein 40
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: TRIM40
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:QQWLGQLEHMPAEAARILDISRAVTQLRSLVIDLERTAKELDTNTLKNAGDLLNRSAPQKLEVIYPQLEKGVSELLLQP
• Quantity: 0.1 mL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 135644
• Target Species: Human
• Isotype: IgG

For Research Use Only