Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRIM42 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | TRIM42 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TRIM42 Polyclonal specifically detects TRIM42 in Human samples. It is validated for Western Blot.Specifications
| TRIM42 | |
| Polyclonal | |
| Rabbit | |
| Q8IWZ5 | |
| 287015 | |
| Synthetic peptides corresponding to TRIM42(tripartite motif-containing 42) The peptide sequence was selected from the C terminal of TRIM42. Peptide sequence VKTPGPIVIYQTLVYPRAAKVYWTCPAEDVDSFEMEFYEVITSPPNNVQM. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ40097, MGC163346, tripartite motif containing 42, tripartite motif-containing 42, tripartite motif-containing protein 42 | |
| TRIM42 | |
| IgG | |
| 80 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title