Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRIM42 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | TRIM42 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP155074
|
Novus Biologicals
NBP155074 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
TRIM42 Polyclonal specifically detects TRIM42 in Human samples. It is validated for Western Blot.Specifications
TRIM42 | |
Polyclonal | |
Rabbit | |
Q8IWZ5 | |
287015 | |
Synthetic peptides corresponding to TRIM42(tripartite motif-containing 42) The peptide sequence was selected from the C terminal of TRIM42. Peptide sequence VKTPGPIVIYQTLVYPRAAKVYWTCPAEDVDSFEMEFYEVITSPPNNVQM. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ40097, MGC163346, tripartite motif containing 42, tripartite motif-containing 42, tripartite motif-containing protein 42 | |
TRIM42 | |
IgG | |
80 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title