TRIM43 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155071

Catalog No. NBP155071

Description

TRIM43 Polyclonal specifically detects TRIM43 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TRIM43
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: tripartite motif containing 43, tripartite motif-containing 43, tripartite motif-containing protein 43
• Host Species: Rabbit
• Molecular Weight of Antigen: 52 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96BQ3
• Gene Symbols: TRIM43
• Immunogen: Synthetic peptides corresponding to TRIM43(tripartite motif-containing 43) The peptide sequence was selected from the C terminal of TRIM43. Peptide sequence NSTMVNSEDIFLLLCLKVDNHFNLLTTSPVFPHYIEKPLGRVGVFLDFES.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 129868
• Target Species: Human
• Isotype: IgG

For Research Use Only