Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRIM58 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$158.00 - $501.50
Specifications
Antigen | TRIM58 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP17970620
![]() |
Novus Biologicals
NBP17970620UL |
20 μL |
Each for $158.00
|
|
|||||
NBP179706
![]() |
Novus Biologicals
NBP179706 |
100 μL |
Each for $501.50
|
|
|||||
Description
TRIM58 Polyclonal specifically detects TRIM58 in Human samples. It is validated for Western Blot.Specifications
TRIM58 | |
Polyclonal | |
Rabbit | |
Zinc Finger | |
NP_056246 | |
25893 | |
Synthetic peptide directed towards the middle region of human TRIM58The immunogen for this antibody is TRIM58. Peptide sequence FNQLFSGLLRPYFFICDATPLILPPTTIAGSGNWASRDHLDPASDVRDDH. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Human | |
BIA2, DKFZp434C091, Protein BIA2, tripartite motif containing 58, tripartite motif-containing 58, tripartite motif-containing protein 58 | |
TRIM58 | |
IgG | |
55 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title