Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TRIM67 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | TRIM67 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TRIM67 Polyclonal specifically detects TRIM67 in Human samples. It is validated for Western Blot.Specifications
TRIM67 | |
Polyclonal | |
Rabbit | |
FLJ44831, TNLTRIM9-like protein TNL, TRIM9-like protein, tripartite motif containing 67, tripartite motif-containing 67, tripartite motif-containing protein 67 | |
TRIM67 | |
IgG | |
84 kDa |
Western Blot | |
Unconjugated | |
RUO | |
440730 | |
Synthetic peptides corresponding to TRIM67(tripartite motif-containing 67) The peptide sequence was selected from the C terminal of TRIM67. Peptide sequence GGVCKGATVGVLLDLNKHTLTFFINGQQQGPTAFSHVDGVFMPALSLNRN. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title