TRIM8 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310336100UL

Catalog No. NB125573

Description

TRIM8 Polyclonal specifically detects TRIM8 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TRIM8
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: EC 6.3.2.-, GERP, GERPRING finger protein 27glioblastoma expressed ring finger protein, Glioblastoma-expressed RING finger protein, RNF27probable E3 ubiquitin-protein ligase TRIM8, tripartite motif containing 8, tripartite motif protein TRIM8, tripartite motif-containing 8, Tripartite motif-containing protein 8
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIM8 (NP_112174). Peptide sequence QSVPLYPCGVSSSGAEKRKHSTAFPEASFLETSSGPVGGQYGAAGTASGE
• Quantity: 100 μg
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 81603
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified