Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TrkA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP23826525UL
Description
TrkA Polyclonal specifically detects TrkA in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
TrkA | |
Polyclonal | |
Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
P04629 | |
NTRK1 | |
This antibody was developed against a recombinant protein corresponding to amino acids: KSGLRFVAPDAFHFTPRLSRLNLSFNALESLSWKTVQGLSLQELVLSGNPLHCSCALRWLQRWEEEGLGGVPEQKLQCHGQG | |
25 μL | |
Adaptive Immunity, Cancer, Immunology, Neuroscience, Protein Kinase | |
4914 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
DKFZp781I14186, EC 2.7.10, EC 2.7.10.1, MTChigh affinity nerve growth factor receptor, Neurotrophic tyrosine kinase receptor type 1, neurotrophic tyrosine kinase, receptor, type 1, p140-TrkA, TRK1-transforming tyrosine kinase protein, Trk-A, TRKAOncogene TRK, TRKTRK1, tyrosine kinase receptor A | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction